PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF100100070CFD_t1
Common NameTRAES_3BF100100070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 270aa    MW: 28769.1 Da    PI: 6.3497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF100100070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.4e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++eEd+ l d+ +++G+  +W t +++ g++R++k+c++rw++yl
  TRAES3BF100100070CFD_t1 14 RGPWSPEEDDALRDYMQRHGNTgSWITLPSKAGLKRCGKSCRLRWLNYL 62
                             89*********************************************97 PP

2Myb_DNA-binding45.12.3e-1469111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +T+eEd +++ +  qlG++ W++Ia+ +  +Rt++++k++w++
  TRAES3BF100100070CFD_t1  69 GGFTEEEDTIIYSLYSQLGSK-WSLIASQLE-RRTDNDVKNHWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.488962IPR017930Myb domain
SuperFamilySSF466892.43E-2612109IPR009057Homeodomain-like
SMARTSM007171.1E-91364IPR001005SANT/Myb domain
PfamPF002492.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-221569IPR009057Homeodomain-like
CDDcd001672.19E-71662No hitNo description
PROSITE profilePS5129422.33863117IPR017930Myb domain
SMARTSM007178.6E-1267115IPR001005SANT/Myb domain
PfamPF002491.6E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2270117IPR009057Homeodomain-like
CDDcd001677.03E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRAPCCDRA AVKRGPWSPE EDDALRDYMQ RHGNTGSWIT LPSKAGLKRC GKSCRLRWLN  60
YLRPDIRHGG FTEEEDTIIY SLYSQLGSKW SLIASQLERR TDNDVKNHWN TKLKKRLAAA  120
AAAFSTAPCR RSPSFMPLPA PAPAHAHLSP LLPLPVPTVK AEAYTYDDFL APTAGLQDPF  180
AAEGSSSASA ALQDTFAAEG SSSASAALQD TLAAEGSTSA SAASSGSNWS AVDNAGGFFV  240
DFCAAGPDLA AADQFLGGFY YPLDSTLSLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519080.0JF951908.1 Triticum aestivum clone TaMYB25 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455023.17e-99hypothetical protein SORBIDRAFT_03g003120
TrEMBLA0A077RQD40.0A0A077RQD4_WHEAT; Uncharacterized protein
STRINGMLOC_67874.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.16e-65MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]